NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold CSTRM4_103293

Scaffold CSTRM4_103293


Overview

Basic Information
Taxon OID3300001758 Open in IMG/M
Scaffold IDCSTRM4_103293 Open in IMG/M
Source Dataset NameM4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1532
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.Bin009(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From Belvaux, Luxembourg

Source Dataset Sampling Location
Location NameCRP-GL Belvaux Luxembourg
CoordinatesLat. (o)49.506095Long. (o)5.943536Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F103315Metagenome / Metatranscriptome101N

Sequences

Protein IDFamilyRBSSequence
CSTRM4_1032931F103315N/ADNRLYGNLFAAGFAGILSGLLALWSFNENTVYITTVPGTAITVDHYLNDTLANVTTTYAYQTHIVPIVDPALGYFWMLVMVFMWFLVGYFVLEIMHESRMPDDEEAYE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.