NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold CSTRM20_103720

Scaffold CSTRM20_103720


Overview

Basic Information
Taxon OID3300001756 Open in IMG/M
Scaffold IDCSTRM20_103720 Open in IMG/M
Source Dataset NameWastewater microbial communities from Belvaux, Luxembourg - M20
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1532
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From Belvaux, Luxembourg

Source Dataset Sampling Location
Location NameBelvaux, Luxembourg
CoordinatesLat. (o)49.506095Long. (o)5.943536Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F072352Metagenome / Metatranscriptome121Y
F080011Metagenome / Metatranscriptome115N

Sequences

Protein IDFamilyRBSSequence
CSTRM20_1037203F080011GAGGMTWDELEELRDRLSNILERERAEDGFSPIEEDYYVLYRQAARRAVADINPDHSRDRDHYRILQEIYDAVGEIYDIRSAKLRMAVQDRVVFRRDVDRPENLTVEEQERYDMAISLGGHNAAE*
CSTRM20_1037204F072352GGGGGMSSKTSRIADLRRAPTVVHLPGCPNGCGEMLALDDGWQCPVCNWYRGYYRGERHP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.