Scaffold CSTRM28_100220

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold CSTRM28_100220

Scaffold CSTRM28_100220

Overview

Basic Information
Taxon OID	3300001754 Open in IMG/M
Scaffold ID	CSTRM28_100220 Open in IMG/M
Source Dataset Name	Wastewater microbial communities from Belvaux, Luxembourg - M28
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	36608
Total Scaffold Genes	29 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	20 (68.97%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Cloacimonetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From Belvaux, Luxembourg

Source Dataset Sampling Location
Location Name	Belvaux, Luxembourg
Coordinates	Lat. (^o)	49.506095	Long. (^o)	5.943536	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088944	Metagenome / Metatranscriptome	109	N

Sequences

Protein ID	Family	RBS	Sequence
CSTRM28_10022016	F088944	GGA	MKNEDFEKALFESYLDSIEDKFDFEVDTIEIEDLTNESGEAKIIIKDKDIIEPLDTQVLGTIRQLSHKGKLINYVPVELQENGLYLVMKASSFVHYALNIDIIALGYSGKYLIDPYNNFLLYPEEIENSVLLDYLDTFSVFHLQEALKNSLTEKQEGKRIMYSDITESWKLEFRIKEYQLTSYFRFRNLNVNSVDLTTIVDLLMKKEELSINKYAAARPTLTEAFDLMKQPKSSNIFYALNHTLVRESDARVLIYPDDEYIGKAGKIYICSECVFDGYIPKKLCLGVIAFKDLISIQEVLNIRIEIEEE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.