NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI2171J19970_10024021

Scaffold JGI2171J19970_10024021


Overview

Basic Information
Taxon OID3300001753 Open in IMG/M
Scaffold IDJGI2171J19970_10024021 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from White Oak River estuary, North Carolina - WOR-3-24_28
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2627
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (14.29%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment → Marine Sediment Microbial Communities From White Oak River Estuary, North Carolina

Source Dataset Sampling Location
Location NameWhite Oak River estuary, North Carolina, USA
CoordinatesLat. (o)34.640199Long. (o)-77.109447Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006546Metagenome / Metatranscriptome370Y
F010915Metagenome / Metatranscriptome297Y

Sequences

Protein IDFamilyRBSSequence
JGI2171J19970_100240213F006546N/AMKWKYIGNRAGDAKKGEQYIVEICEDTENHAKKDMPQFITVVVVQPPSPRNNTFFSMRTGDTIKICNPYYEMMKYSHPGFVPVKE*
JGI2171J19970_100240215F010915GAGGMKQKLPPHNMIVVVQIGLDLYSLSYVKYVDHDVVQHVKHNLSSEDVAQFLGNN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.