Scaffold JGI11772J19994_1046761

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI11772J19994_1046761

Scaffold JGI11772J19994_1046761

Overview

Basic Information
Taxon OID	3300001748 Open in IMG/M
Scaffold ID	JGI11772J19994_1046761 Open in IMG/M
Source Dataset Name	Saline surface water microbial communities from Etoliko Lagoon, Greece - surface water (0 m)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	520
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment → Saline Water And Sediment Microbial Community From Etoliko Lagoon, Greece

Source Dataset Sampling Location
Location Name	Etoliko Lagoon, Greece
Coordinates	Lat. (^o)	38.4825	Long. (^o)	21.315	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064578	Metagenome	128	N

Sequences

Protein ID	Family	RBS	Sequence
JGI11772J19994_10467611	F064578	N/A	FQGDAAKIYNMIKDNHVMTLPEISFAIDKSLNQFSGRISELLDAGLIKEMKGDKYSLFRVTQSEQEKYECSKMRHNEKIEKLRKKADSLGYFLVKKMW*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.