NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24656J20076_1024350

Scaffold JGI24656J20076_1024350


Overview

Basic Information
Taxon OID3300001740 Open in IMG/M
Scaffold IDJGI24656J20076_1024350 Open in IMG/M
Source Dataset NameMarine viral communities from the Deep Pacific Ocean - MSP-114
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)678
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)14.5287Long. (o)-118.7737Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F050302Metagenome / Metatranscriptome145N

Sequences

Protein IDFamilyRBSSequence
JGI24656J20076_10243503F050302AGGAGMNVDSRVITLALFLIAQSVGAIWWASGLSSEVERLSGLVDKSDQFQTEIQRAVSGLDVLNFKVEELWKAIERLEEGKTIWSCR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.