Scaffold JGI24656J20076_1000286

Overview

Basic Information

• Taxon OID: 3300001740
• Scaffold ID: JGI24656J20076_1000286
• Source Dataset Name: Marine viral communities from the Deep Pacific Ocean - MSP-114
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 7635
• Total Scaffold Genes: 21
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 8 (38.10%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 14.5287
  • Long. (^o): -118.7737

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047110	Metagenome	150	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24656J20076_10002868	F047110	N/A	MKNNKIKTNKMKTVVSINWRIRDLIREKLSFEKWHLDVFDSPAPKKVLNKIKAKAKELAEMKQAVLLAAKDEASA*