NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24024J18818_10230965

Scaffold JGI24024J18818_10230965


Overview

Basic Information
Taxon OID3300001685 Open in IMG/M
Scaffold IDJGI24024J18818_10230965 Open in IMG/M
Source Dataset NameOil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)509
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine → Marine Microbial Communities From The Santa Barbara Channel Oil Seeps

Source Dataset Sampling Location
Location NameCoal Oil Point, Santa Barbara, CA
CoordinatesLat. (o)34.39192Long. (o)-119.84578Alt. (m)Depth (m)47
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F090428Metagenome / Metatranscriptome108Y

Sequences

Protein IDFamilyRBSSequence
JGI24024J18818_102309651F090428N/AMKTNNKVITNELINEKLEAIGFGDEQASDQDLAKESVLKHFNVEFVNNWNNKADFYIYEESTVDGYSVHVATHDMNNVN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.