Scaffold GBIDBA_10130173

Overview

Basic Information

• Taxon OID: 3300001683
• Scaffold ID: GBIDBA_10130173
• Source Dataset Name: Hydrothermal vent plume microbial communities from Guaymas Basin, Gulf of California - IDBA assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 685
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Marine Group I → Marine Group I thaumarchaeote (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From Guaymas Basin, Pacific Ocean

Source Dataset Sampling Location

• Location Name: Guyams Basin, Gulf of California, Pacific Ocean
• Coordinates
  • Lat. (^o): 27.015833
  • Long. (^o): -111.425
  • Depth (m): 1993

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002854	Metagenome / Metatranscriptome	526	Y

Sequences

Protein ID	Family	RBS	Sequence
GBIDBA_101301732	F002854	AGGA	MTIEEVDKIISDLRNQIPSMQMQLHQAEGYKQALVDSEKEKEGKDTKPKT*