NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GBIDBA_10014471

Scaffold GBIDBA_10014471


Overview

Basic Information
Taxon OID3300001683 Open in IMG/M
Scaffold IDGBIDBA_10014471 Open in IMG/M
Source Dataset NameHydrothermal vent plume microbial communities from Guaymas Basin, Gulf of California - IDBA assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8319
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From Guaymas Basin, Pacific Ocean

Source Dataset Sampling Location
Location NameGuyams Basin, Gulf of California, Pacific Ocean
CoordinatesLat. (o)27.015833Long. (o)-111.425Alt. (m)Depth (m)1993
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F068852Metagenome / Metatranscriptome124Y

Sequences

Protein IDFamilyRBSSequence
GBIDBA_100144717F068852N/AMALLKFSPMAYIKYFALNAPMILAAFVIFASAFNKDIKGLIFMAGAVIIMFIGQFISSALGRKPPENIDLAACNMFSSSGWGFEWSAPAPNALFLAYAATYFIAAMAFHQNFNWALLGMLIVIMTTNAGFRLKLLHCGTSIDLLFGWTFGIIWGLLWYGCMAMIESQHDGTISLTYFGDNSGVDKCKITNKKFKCRNI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.