Scaffold GBIDBA_10000959

Overview

Basic Information

• Taxon OID: 3300001683
• Scaffold ID: GBIDBA_10000959
• Source Dataset Name: Hydrothermal vent plume microbial communities from Guaymas Basin, Gulf of California - IDBA assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 83358
• Total Scaffold Genes: 102
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 12 (11.76%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From Guaymas Basin, Pacific Ocean

Source Dataset Sampling Location

• Location Name: Guyams Basin, Gulf of California, Pacific Ocean
• Coordinates
  • Lat. (^o): 27.015833
  • Long. (^o): -111.425
  • Depth (m): 1993

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040567	Metagenome / Metatranscriptome	161	Y

Sequences

Protein ID	Family	RBS	Sequence
GBIDBA_1000095966	F040567	N/A	MGKNNNMKKYIVVERNRKFDSFDLINEDTNGLNEIWESHIPYKLNEDEKPNVRPLIFDNRSEAVKYKNKAQSDRDRDWRENDYIYKSFGDLKPKWKIEEYTGNLFK*