Basic Information | |
---|---|
Taxon OID | 3300001682 Open in IMG/M |
Scaffold ID | SAHD_10025190 Open in IMG/M |
Source Dataset Name | Cattle waste upflow reactor |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 5826 |
Total Scaffold Genes | 11 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (36.36%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Activated Sludge → Activated Sludge → Activated Sludge Microbial Communities From The University Of Illinois, Usa, From Bioreactors Seeded With Cattle Waste |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: University of Illionis | |||||||
Coordinates | Lat. (o) | 40.103885 | Long. (o) | -88.225087 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F039153 | Metagenome / Metatranscriptome | 164 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
SAHD_100251905 | F039153 | N/A | MKYTVSSSEKSKMYNTEVIFFNNSKQASRLNVSPLHKEIKQWAKSQGYTPKLYLRSVAIECNNPDLPKEYELLVVDLIQIIANGQAYLVAIDTLGPSENNLHFILEEHAKLRKAIYVTAECLDDVICEIQDNEHNHKGDPCVPDIKSRRSFQGDYSILFSPENLTWKTARYERA* |
⦗Top⦘ |