Scaffold Abe_10126864

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Abe_10126864

Scaffold Abe_10126864

Overview

Basic Information
Taxon OID	3300001681 Open in IMG/M
Scaffold ID	Abe_10126864 Open in IMG/M
Source Dataset Name	Black smokers hydrothermal plume microbial communities from Abe, Lau Basin, Pacific Ocean - IDBA
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1286
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From Abe, Lau Basin, Pacific Ocean

Source Dataset Sampling Location
Location Name	Abe, ELSC, Pacific Ocean
Coordinates	Lat. (^o)	-20.111307	Long. (^o)	-176.989014	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F101850	Metagenome	102	Y

Sequences

Protein ID	Family	RBS	Sequence
Abe_101268642	F101850	N/A	LNIKNKFYIISVGFPTTTINEFRNKHCGRGGSTPPPPLTTYGGELESTSV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.