Scaffold Abe_10121886

Overview

Basic Information

• Taxon OID: 3300001681
• Scaffold ID: Abe_10121886
• Source Dataset Name: Black smokers hydrothermal plume microbial communities from Abe, Lau Basin, Pacific Ocean - IDBA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2097
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From Abe, Lau Basin, Pacific Ocean

Source Dataset Sampling Location

• Location Name: Abe, ELSC, Pacific Ocean
• Coordinates
  • Lat. (^o): -20.111307
  • Long. (^o): -176.989014

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016759	Metagenome / Metatranscriptome	245	Y

Sequences

Protein ID	Family	RBS	Sequence
Abe_101218865	F016759	AGGAG	MSKLTRKMKRYTELNKQMIKDQLLRVKHPAAGALNVPVNLVDQVTTLTFIQLGQPNTILDMYNAVDPAGTATYEYGLDKNSISTGRTFFSNAMSTASAGRAAVGPLRINQGQLQMTGTPTTALAPALDQNIVIKFANGF*