NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Draft_10665190

Scaffold Draft_10665190


Overview

Basic Information
Taxon OID3300001605 Open in IMG/M
Scaffold IDDraft_10665190 Open in IMG/M
Source Dataset NameTailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMcGill University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)526
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location
Location NameFort McMurray in northeastern Alberta, Canada
CoordinatesLat. (o)57.01116Long. (o)-111.6Alt. (m)Depth (m)0 to .1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009748Metagenome / Metatranscriptome313Y

Sequences

Protein IDFamilyRBSSequence
Draft_106651902F009748N/AEAWHGFFDTNGALITTGGTGGLYQFFNGYINSFTINEQWMEEVREFLGVITVSASSIQLILKNRTAGRYTNDNSWQFFNNGDTSMNRVAFVSTINYYFGKGASPNS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.