Scaffold EMG_10026481

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold EMG_10026481

Scaffold EMG_10026481

Overview

Basic Information
Taxon OID	3300001598 Open in IMG/M
Scaffold ID	EMG_10026481 Open in IMG/M
Source Dataset Name	Elephant fecal microbiome from Asian Elephant in Hamburg Zoo, Germany
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6502
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Asian Elephant Fecal → Asian Elephant Fecal Microbial Communities From Hamburg Zoo, Germany

Source Dataset Sampling Location
Location Name	Hagenbeck zoo/Hamburg, Germany
Coordinates	Lat. (^o)	53.595256	Long. (^o)	9.941572	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072445	Metagenome / Metatranscriptome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
EMG_100264811	F072445	N/A	MAVVSDLVRGGDGYMKFIDYEKTYRDDNKEFLRGDMWQFSFTSAPKIVYYPGDTIMNARLNSVNVSLDSSVNGFEKRMRGNFVIKQQTGQQTSGNLTLSFIDKEDQAISYFVDDWKQKVADRDTKYSFRKDDLVADCQLVLTNSSRISVRTLDFYNCIIQDAPLDENGVAEDGTDRADVQLSLFFEHYTRSFNNL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.