Scaffold Draft_10146424

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Draft_10146424

Scaffold Draft_10146424

Overview

Basic Information
Taxon OID	3300001592 Open in IMG/M
Scaffold ID	Draft_10146424 Open in IMG/M
Source Dataset Name	Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes in water sample from Medicine Hat oil field -PW_MHGC_2012April2:
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	McGill University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1002
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location
Location Name	Medicine Hat, Alberta, Canada
Coordinates	Lat. (^o)	50.033333	Long. (^o)	-110.666667	Alt. (m)		Depth (m)	800
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F105264	Metagenome / Metatranscriptome	100	N

Sequences

Protein ID	Family	RBS	Sequence
Draft_101464241	F105264	N/A	MDKLHPLAVSICSLLFGEGLGYLFVPSESILSQILRALSYFVAIIASILAIVVSIKKLQDDEQRNNKATTNKDES*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.