Scaffold JGI11880J15749_1006886

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI11880J15749_1006886

Scaffold JGI11880J15749_1006886

Overview

Basic Information
Taxon OID	3300001585 Open in IMG/M
Scaffold ID	JGI11880J15749_1006886 Open in IMG/M
Source Dataset Name	Marine microbial communities from the Deep Atlantic Ocean - MP2913
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	987
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location Name	West of Santa Cruz de la Palma, Atlantic Ocean
Coordinates	Lat. (^o)	29.97	Long. (^o)	-23.69	Alt. (m)		Depth (m)	4003.49
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037770	Metagenome	167	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI11880J15749_10068863	F037770	N/A	TPSPKFKASRPLAFNADTMVDLPEPGMPVRQTISFAKMKLFTDSSL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.