NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Draft_10280185

Scaffold Draft_10280185


Overview

Basic Information
Taxon OID3300001580 Open in IMG/M
Scaffold IDDraft_10280185 Open in IMG/M
Source Dataset NameWastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMcGill University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)723
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location
Location NameSuncor Tailings Pond 6, Northern Alberta, Canada
CoordinatesLat. (o)57.05Long. (o)-111.55Alt. (m)Depth (m)6
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F075409Metagenome119Y

Sequences

Protein IDFamilyRBSSequence
Draft_102801851F075409AGGAGGMNETETLKSIFDELCKSAVNIFHSEEEVMSFIFIFPKEGNMVPVIPINGNKEAVSRLIQDICLKVGAIAGPIVSEGWSVTLDKGKSWDETLPSKHLDRVEILQVSLYSKSINRLKTWKIIRNGETKSLEDYFGGDSPDRVESRFFGDYFRTDA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.