Basic Information | |
---|---|
Taxon OID | 3300001567 Open in IMG/M |
Scaffold ID | Draft_10005260 Open in IMG/M |
Source Dataset Name | Hydrocarbon resource environments microbial communities from Canada and USA - Toluene degrading community from Alberta, Canada |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | McGill University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 11969 |
Total Scaffold Genes | 23 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 17 (73.91%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp. | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Northern Alberta, Canada | |||||||
Coordinates | Lat. (o) | 54.0 | Long. (o) | -114.0 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F064746 | Metagenome / Metatranscriptome | 128 | N |
F091989 | Metagenome / Metatranscriptome | 107 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Draft_1000526015 | F064746 | GGAG | MNKIIWIALILLLGVFAIGGMSSTNGNDGAKNVTIDGYTFEGDFDDKWTNGYGDTETYKPANLEDIQFGIPDGAYDWTGIENYHAFYYDSGEPSGSITKYGWANIFVLKPNEDMVNVLKSATRLLINPRNHRNAVVAGDLTEKYIEYNGRQAYLVEIKEELMDGFVDYRDYAAIAFFLDDGKVCVIDAFTTDNFGMSAWDIIDSITVTP* |
Draft_100052605 | F091989 | GGA | MTLSAYARSIINVAKVNGYASDASKAGDALIRPFGELDDQKTTLISLQVSTMALCWIDANGKAVPFDSAEFNAVQKEIAALQAKIDHNAAILDKLDAKVAELGLSEFSLAKLKGEIEKRRGQIAQIRAEENDSLRSKWESVVSLGGNRATYDKLPEVIDARAKAAEKIAPIESEIKALNGQIRSLESILSKFTR* |
⦗Top⦘ |