NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI20215J15232_1005458

Scaffold JGI20215J15232_1005458


Overview

Basic Information
Taxon OID3300001547 Open in IMG/M
Scaffold IDJGI20215J15232_1005458 Open in IMG/M
Source Dataset NameWetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site C1 Bulk
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1933
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Wetland → Microbial Community Impact On Carbon Sequestration In Managed Wetland Carbon Farming

Source Dataset Sampling Location
Location NameTwitchell Island, Sacramento and San Joaquin Delta, California, USA
CoordinatesLat. (o)38.1075Long. (o)-121.6497Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F097608Metagenome104Y

Sequences

Protein IDFamilyRBSSequence
JGI20215J15232_10054582F097608N/AMSNFEQGMSNGEVKSFVFFPSAFDIRYSIFCRSFLNFCTPNKAVPI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.