NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold A2065W1_10160726

Scaffold A2065W1_10160726


Overview

Basic Information
Taxon OID3300001537 Open in IMG/M
Scaffold IDA2065W1_10160726 Open in IMG/M
Source Dataset NamePermafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illumina
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Tennessee
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1345
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost And Active Layer Microbial Communities From Mcgill Arctic Research Station (Mars)

Source Dataset Sampling Location
Location NameAxel Heiberg Island, Nunavut, Canada
CoordinatesLat. (o)79.26Long. (o)-90.46Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005108Metagenome / Metatranscriptome412Y

Sequences

Protein IDFamilyRBSSequence
A2065W1_101607261F005108GGAGMTTVSGARQGHTHRRQAAPMKAMFGFLTPQAKDLSDPLQNAKVAAVWLRQLPSLDVIGRQQQVIAVLDTMRKTQRAPDLNRINALQFVDAALGADRRQLIRQYIENAESAPKLADRIWQALWEMSQSFMLAYQSALETAVLEANNARWKAALPLLFVRLVHFHGTDAKLRVFKYERWIPAKWIELHGTYLRSCEMHCDRQPVALPAAGAAAQPWSVEQEYLYVLLVHQLNTGNLS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.