Scaffold MLSed_10029865

Overview

Basic Information

• Taxon OID: 3300001533
• Scaffold ID: MLSed_10029865
• Source Dataset Name: Benthic freshwater microbial communities from British Columbia, Canada
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3342
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (57.14%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Parcubacteria → unclassified Parcubacteria → Candidatus Parcubacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Benthic → Benthic Freshwater Sediment Microbial Communities From British Columbia, Canada

Source Dataset Sampling Location

• Location Name: British Columbia, Canada
• Coordinates
  • Lat. (^o): 49.283333
  • Long. (^o): -119.583333

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007110	Metagenome / Metatranscriptome	357	Y

Sequences

Protein ID	Family	RBS	Sequence
MLSed_100298656	F007110	AGAAGG	MNCIYCSEDVGFDRYEFLVETGRKIVCKDCSVENRAVGYMSYSHKTAPELVLCPANATEKLRILDRANRRAR*