Scaffold Abe_1153693

Overview

Basic Information

• Taxon OID: 3300001524
• Scaffold ID: Abe_1153693
• Source Dataset Name: Abe Hydrothermal Plume
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1172
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From Abe, Lau Basin, Pacific Ocean (2)

Source Dataset Sampling Location

• Location Name: Abe
• Coordinates
  • Lat. (^o): -21.0
  • Long. (^o): 176.0
  • Depth (m): 2100

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033390	Metagenome	177	Y

Sequences

Protein ID	Family	RBS	Sequence
Abe_11536931	F033390	N/A	QTGTVPQTISIDGIFNKWSGIGLGSWIYGMIPVKQLPHKAKAKTLGKALLSGGVLGGLFSTGNPHNTNLLTTSRPALTVSSSQVSYT*