Scaffold JGI20168J15290_1015895

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI20168J15290_1015895

Scaffold JGI20168J15290_1015895

Overview

Basic Information
Taxon OID	3300001466 Open in IMG/M
Scaffold ID	JGI20168J15290_1015895 Open in IMG/M
Source Dataset Name	Nasutitermes corniger midgut segment microbial community from laboratory colony in Florida, USA - Nc150M
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	508
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany

Source Dataset Sampling Location
Location Name	laboratory colony in Florida, USA
Coordinates	Lat. (^o)	26.0625	Long. (^o)	-80.2332	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006310	Metagenome	376	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI20168J15290_10158951	F006310	GGAG	LNVTHKKPYKRYERKTNDLLIAFIGYVNYLNKLQQFKVSVQKSPPSTSMHFF

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.