NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24003J15210_10002666

Scaffold JGI24003J15210_10002666


Overview

Basic Information
Taxon OID3300001460 Open in IMG/M
Scaffold IDJGI24003J15210_10002666 Open in IMG/M
Source Dataset NameMarine viral communities from the Pacific Ocean - LP-28
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7837
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (70.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)48.9699Long. (o)-130.6666Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011254Metagenome / Metatranscriptome293Y
F052580Metagenome / Metatranscriptome142Y

Sequences

Protein IDFamilyRBSSequence
JGI24003J15210_1000266610F052580GGAGGMHKTVAHGCSFTRYKWPCWPKFVPWFDGGITMLNKGRSASGNETISRATINSAMKHKGIAHMYIMWSAVDRYEVITLDEGVDHLEGRITYRVWDDDFKWSTWFGGHRLPDKHDYYRRHFWNEQHQQYRTLEHIQRAQMFLDKKKIPYTMMIFNKDVIRDKFYSESEKALYNEIDWTKFVFYGDRKGLWEFAEDNYKQYYIPG
JGI24003J15210_100026663F011254N/AMQVQIFTKVDASFECIGLDGNTISQSGTITMPNRWHKCHINLHRRDITDIKIGNESIKHCLNSGNNTIDGYEIWLHGDPARYFSRISECIAIDDLLRFKNLKDKYLITESWNIQVEGDFIPASVKQFFATGEGPHWYHKDDFHNLPYIQHDGDVDTDVDLDEDLQFTDTKFYGQGQCKSLKPHPVLPTIKLEQIKNKKLRDAMGSFGFKEILQMQYVELQPNSVLPIHMDDFTYEDGKSIIDGPTQLYCVLSGDPKDIKFKFKNVGLIDVSKPIFINNRRFVHSLVYTGTIPRGVLLAYGIKQAR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.