Scaffold F14TB_109787120

Overview

Basic Information

• Taxon OID: 3300001431
• Scaffold ID: F14TB_109787120
• Source Dataset Name: Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 538
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Ornithinibacillus → Ornithinibacillus scapharcae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From Kansas Great Prairie, Usa, Amended With Brdu

Source Dataset Sampling Location

• Location Name: Kanza Prairie, Kansas, USA
• Coordinates
  • Lat. (^o): 39.100992
  • Long. (^o): -96.608258

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036008	Metagenome / Metatranscriptome	171	Y

Sequences

Protein ID	Family	RBS	Sequence
F14TB_1097871201	F036008	N/A	VSVMAGVLEAMRLDIGGDPFGVPTTFQELTADGTWSNHKPSGDTVMLVDLTIAPSYHGSGLFEAFVEFARINLESPSGVILTYSPLFHDQNRYWVVRKHEHLGAQLTREIRRSRPGLTMQVRGEELMAEDVGIAAYRCR*