Scaffold F14TB_101385537

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold F14TB_101385537

Scaffold F14TB_101385537

Overview

Basic Information
Taxon OID	3300001431 Open in IMG/M
Scaffold ID	F14TB_101385537 Open in IMG/M
Source Dataset Name	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	940
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From Kansas Great Prairie, Usa, Amended With Brdu

Source Dataset Sampling Location
Location Name	Kanza Prairie, Kansas, USA
Coordinates	Lat. (^o)	39.100992	Long. (^o)	-96.608258	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047984	Metagenome	149	Y

Sequences

Protein ID	Family	RBS	Sequence
F14TB_1013855371	F047984	N/A	VHASIIDMTLRLPVDDMLFDEFRSDFLPRAARHPGFRGFQHVLAEHGRAIGILWYEQPEDLDGITQLVGTWFQDRIAPRLAGPETAVRGRVVVNMSPPRATRT*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.