Basic Information | |
---|---|
Taxon OID | 3300001425 Open in IMG/M |
Scaffold ID | yes_11461520 Open in IMG/M |
Source Dataset Name | Goat rumen bacterial communities from Langston, Oklahoma, USA - velvet |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Cornell University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1098 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Goat Rumen → Goat Rumen Microbial Communities From Langston University, Oklahoma, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Langston, Oklahoma, USA | |||||||
Coordinates | Lat. (o) | 35.453976 | Long. (o) | -97.515884 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F023997 | Metagenome / Metatranscriptome | 208 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
yes_114615201 | F023997 | AGGA | MITLKNWKEQQPEVVYFVQTNFQGDEFMKKLVRSEMNKEAWDKTVAKYSDREIYKVITENHSGELHRWVYFKEGE |
⦗Top⦘ |