Scaffold JGI11705J14877_10080073

Overview

Basic Information

• Taxon OID: 3300001419
• Scaffold ID: JGI11705J14877_10080073
• Source Dataset Name: Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1011
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura → Cyclorrhapha → Schizophora → Calyptratae → Hippoboscoidea → Glossinidae → Glossina → Nemorhina → Glossina palpalis → Glossina palpalis gambiensis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment → Saline Water And Sediment Microbial Community From Etoliko Lagoon, Greece

Source Dataset Sampling Location

• Location Name: Greece: Etoliko Lagoon
• Coordinates
  • Lat. (^o): 38.4825
  • Long. (^o): 21.315
  • Depth (m): 15

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017421	Metagenome / Metatranscriptome	241	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI11705J14877_100800731	F017421	GGAG	MYTLEKRKMIYIMTRKPVWYHTHCVTPWRGTPIYYDPNWVIGDCELCRMDVKGQDWWNGCSYNNSQKRLF