Scaffold JGI11705J14877_10039273

Overview

Basic Information

• Taxon OID: 3300001419
• Scaffold ID: JGI11705J14877_10039273
• Source Dataset Name: Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1721
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment → Saline Water And Sediment Microbial Community From Etoliko Lagoon, Greece

Source Dataset Sampling Location

• Location Name: Greece: Etoliko Lagoon
• Coordinates
  • Lat. (^o): 38.4825
  • Long. (^o): 21.315
  • Depth (m): 15

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043151	Metagenome / Metatranscriptome	157	N

Sequences

Protein ID	Family	RBS	Sequence
JGI11705J14877_100392731	F043151	N/A	TAQENEYLSSGSYRKSNTNKQRRVKQEPDLRKHDWAIRTTIEVDGKTYIVPVQV*