Scaffold JGI11705J14877_10035140

Overview

Basic Information

• Taxon OID: 3300001419
• Scaffold ID: JGI11705J14877_10035140
• Source Dataset Name: Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1862
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (85.71%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment → Saline Water And Sediment Microbial Community From Etoliko Lagoon, Greece

Source Dataset Sampling Location

• Location Name: Greece: Etoliko Lagoon
• Coordinates
  • Lat. (^o): 38.4825
  • Long. (^o): 21.315
  • Depth (m): 15

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068255	Metagenome	125	N

Sequences

Protein ID	Family	RBS	Sequence
JGI11705J14877_100351402	F068255	AGGAGG	MHNNEQFEVSDWDCFFSDWPTYAEVMDGWHKFWGNTQLLRTYRDKNGRNLKDRDGNILVTRSTTPRQMPIGHSVSDYMNYARPKRSDHTRD*