Scaffold BBDRAFT_10123516

Overview

Basic Information

• Taxon OID: 3300001371
• Scaffold ID: BBDRAFT_10123516
• Source Dataset Name: Baker-B-sed
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of South Carolina
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1620
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location

• Location Name: Baker Bay
• Coordinates
  • Lat. (^o): 46.28551
  • Long. (^o): -124.05187
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076640	Metagenome	118	Y

Sequences

Protein ID	Family	RBS	Sequence
BBDRAFT_101235161	F076640	N/A	IAMLVGIHKWFICCCLRVGMDPTEFLFLILPLAALVIVLVVIVLYLARKQDTIRHKEVETLNELMQTGVMNKDNFYMMLQDLARNKMIEQDSCKTLGKLLQESFNENEETVSNS*