Scaffold A30PFW6_1082337

Overview

Basic Information

• Taxon OID: 3300001361
• Scaffold ID: A30PFW6_1082337
• Source Dataset Name: Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-PF)- 6 month illumina
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Tennessee
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 526
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_66_6 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost And Active Layer Microbial Communities From Mcgill Arctic Research Station (Mars)

Source Dataset Sampling Location

• Location Name: Axel Heiberg Island, Nunavut, Canada
• Coordinates
  • Lat. (^o): 79.26
  • Long. (^o): -90.46

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063203	Metagenome / Metatranscriptome	130	Y

Sequences

Protein ID	Family	RBS	Sequence
A30PFW6_10823372	F063203	GAG	VTAQALVIGRELERLDGLWEDGLSDTYRSYLDSVDAYDKAAQPKLALAAALIEAGLRLQG