Scaffold JGI12269J14319_10056259

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI12269J14319_10056259

Scaffold JGI12269J14319_10056259

Overview

Basic Information
Taxon OID	3300001356 Open in IMG/M
Scaffold ID	JGI12269J14319_10056259 Open in IMG/M
Source Dataset Name	Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2285
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location
Location Name	Germany: Weissenstadt
Coordinates	Lat. (^o)	50.13	Long. (^o)	11.88	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008253	Metagenome / Metatranscriptome	336	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI12269J14319_100562592	F008253	GAG	MSRQLETTISDAATRNLSVTATLEWLADMELEARNHRAIERRFKCSR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.