Scaffold JGI20158J14315_10029454

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI20158J14315_10029454

Scaffold JGI20158J14315_10029454

Overview

Basic Information
Taxon OID	3300001355 Open in IMG/M
Scaffold ID	JGI20158J14315_10029454 Open in IMG/M
Source Dataset Name	Pelagic Microbial community sample from North Sea - COGITO 998_met_08
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2615
Total Scaffold Genes	9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location Name	Helgoland, sampling site Kabeltonne
Coordinates	Lat. (^o)	54.184167	Long. (^o)	7.9	Alt. (m)		Depth (m)	1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001721	Metagenome / Metatranscriptome	647	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI20158J14315_100294545	F001721	AGGAG	MSVWTDERKEIATWLSGYLNMVKTWVDKILDNEHYDVDKXKXIGLIXEWIAWXXETXLXIMKMKDXDPTQIXEKEX*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.