Scaffold JGI20155J14468_10236791

Overview

Basic Information

• Taxon OID: 3300001354
• Scaffold ID: JGI20155J14468_10236791
• Source Dataset Name: Pelagic Microbial community sample from North Sea - COGITO 998_met_05
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 534
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location

• Location Name: Helgoland, sampling site Kabeltonne
• Coordinates
  • Lat. (^o): 54.184167
  • Long. (^o): 7.9
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041202	Metagenome	160	N

Sequences

Protein ID	Family	RBS	Sequence
JGI20155J14468_102367912	F041202	N/A	MELRLPHKWSDLTLGELQVIMTSENQIERLSVCTGKSEDKLRAMPQKLIEAATEHIDKLLTQETARFEKVVQMDGKRFGFIPDWDAFTAGEWIDLETYLEDFWKNAHKVMAVLFREVTYELG