Scaffold JGI20157J14317_10020240

Overview

Basic Information

• Taxon OID: 3300001352
• Scaffold ID: JGI20157J14317_10020240
• Source Dataset Name: Pelagic Microbial community sample from North Sea - COGITO 998_met_07
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3838
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location

• Location Name: Helgoland, sampling site Kabeltonne
• Coordinates
  • Lat. (^o): 54.184167
  • Long. (^o): 7.9
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022641	Metagenome / Metatranscriptome	213	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI20157J14317_100202401	F022641	AGGA	MTTKKYIITKAIANVISGLSMVIIITLGIMYMSFDNAFVFQDIKIEVVNNPIEQHDDIEFMMIGSKKFECNSTKVYGIAYSDDGYMHRLDKFTKQYTRNTRPGEPIPNQWSMAVPDDMIIGGEYRVSMTGVFTCNHLIFQTEKTQTYDNILLIVKPR*