NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI20132J14458_1010660

Scaffold JGI20132J14458_1010660


Overview

Basic Information
Taxon OID3300001339 Open in IMG/M
Scaffold IDJGI20132J14458_1010660 Open in IMG/M
Source Dataset NameHot spring and microbial mat streamer communities from Octopus Spring Streamers, Yellowstone National Park, USA - OCT_B
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1481
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Pyrobaculum → unclassified Pyrobaculum → Pyrobaculum sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring And Microbial Mat Streamer → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameOctopus Spring, Yellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.376Long. (o)-110.69Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013155Metagenome / Metatranscriptome274Y
F075483Metagenome / Metatranscriptome119Y

Sequences

Protein IDFamilyRBSSequence
JGI20132J14458_10106602F075483GAGMMIELLAVQAITNLALAFFVIKLRRELYPMVAAAGQPYASFWIRSVDVLVVEAPQFEAAKTVIRVRWLFSEELHLTYSFRVYDVAMHPYRRHHYVRWRAWMQGDDRYRCEVEKPRGLARIYTKAIDVFCKEKEPPKEVVILPSRWRKRRYKRWTKPVRSGSAPP*
JGI20132J14458_10106603F013155N/AIALANLAVTVWLLRLLFPVWRELRRIVFALDHFDFDKLAKQFLNGEKPLAEAVDIKVSEKKEEGYRELTVTRIYRKPLDPREIQANFVRQMAEKLQ*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.