Scaffold ML7_10049522

Overview

Basic Information

• Taxon OID: 3300001336
• Scaffold ID: ML7_10049522
• Source Dataset Name: ML7
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Pennsylvania State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2034
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (28.57%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Benthic Lake → Benthic Lake Microbial Communities From British Columbia, Canada, For Chemocline Samples

Source Dataset Sampling Location

• Location Name: Wetlands, British Columbia
• Coordinates
  • Lat. (^o): 49.283333
  • Long. (^o): -119.583333

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015419	Metagenome / Metatranscriptome	255	Y

Sequences

Protein ID	Family	RBS	Sequence
ML7_100495223	F015419	N/A	MKYEFKITDEAGNVFLYNVSRSSSDEEKSLNDFILEALEISEDKRELPVKIQCPNGLEVAPSIKMKFENYGSPILGDKLEAMHITWRD*