Scaffold JGI20214J14112_1079931

Overview

Basic Information

• Taxon OID: 3300001279
• Scaffold ID: JGI20214J14112_1079931
• Source Dataset Name: Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 524
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland → Microbial Community Impact On Carbon Sequestration In Managed Wetland Carbon Farming

Source Dataset Sampling Location

• Location Name: Sacramento, California, United States
• Coordinates
  • Lat. (^o): 38.1072
  • Long. (^o): -121.6485
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014730	Metagenome / Metatranscriptome	260	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI20214J14112_10799311	F014730	N/A	GSSCSLDVKMLDTLKDGIVLTIEQNLVDNSNLALITDFVNKHKLSLLLDSECYFISTQALQPSRLSVWEN*