Scaffold B570J13875_100498

Overview

Basic Information

• Taxon OID: 3300001267
• Scaffold ID: B570J13875_100498
• Source Dataset Name: Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2486
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (85.71%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: Lake Mendota, Madison, Wisconsin, USA
• Coordinates
  • Lat. (^o): 43.098333
  • Long. (^o): -89.405278

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000671	Metagenome / Metatranscriptome	945	Y

Sequences

Protein ID	Family	RBS	Sequence
B570J13875_1004986	F000671	AGGAG	MEKILCYSCNKTKNKLNVRRSSLLPINLFLCQTCIDQKLEPRWVILISGRQNGHEHVKEFVQKKRYIGLDITAAELLI*