Basic Information | |
---|---|
Taxon OID | 3300001245 Open in IMG/M |
Scaffold ID | JGI12048J13642_10007703 Open in IMG/M |
Source Dataset Name | Estuarine microbial mat communities from Elkhorn Slough, Moss Landing, CA, USA - CR3B Metatranscriptome (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 660 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Mat Communities From Elkhorn Slough, Moss Landing, Ca, That Are H2-evolving And Photosynthetic |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Elkhorn Slough, Moss Landing, CA | |||||||
Coordinates | Lat. (o) | 36.8 | Long. (o) | -121.8 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F093475 | Metagenome / Metatranscriptome | 106 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI12048J13642_100077031 | F093475 | GAG | LTRWRIQRKTVTPEEAGLCGCRQFIAVWRERHYLRRGRVYKEEQEYSFYVSS |
⦗Top⦘ |