Scaffold JGI12048J13642_10007702

Overview

Basic Information

• Taxon OID: 3300001245
• Scaffold ID: JGI12048J13642_10007702
• Source Dataset Name: Estuarine microbial mat communities from Elkhorn Slough, Moss Landing, CA, USA - CR3B Metatranscriptome (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 644
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Mat Communities From Elkhorn Slough, Moss Landing, Ca, That Are H2-evolving And Photosynthetic

Source Dataset Sampling Location

• Location Name: Elkhorn Slough, Moss Landing, CA
• Coordinates
  • Lat. (^o): 36.8
  • Long. (^o): -121.8

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093475	Metagenome / Metatranscriptome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI12048J13642_100077022	F093475	GAG	LTRWRIQRKTVTPEEAGLCGCRQFIAVWRERHYLRRGRVYKEEQEYSFYVSSVDPQRYDE