Scaffold SwM_113819

Overview

Basic Information

• Taxon OID: 3300001225
• Scaffold ID: SwM_113819
• Source Dataset Name: Switchgrass rhizosphere microbial communities from Knoxville, Tennessee, USA - 11_joined
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Tennessee
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 510
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere → Switchgrass Rhizosphere Microbial Communities From Knoxville, Tennessee, Usa

Source Dataset Sampling Location

• Location Name: East Tennessee Research and Education Center, Knoxville, Tennessee, USA
• Coordinates
  • Lat. (^o): 35.9606
  • Long. (^o): -83.9208

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061048	Metagenome / Metatranscriptome	132	Y

Sequences

Protein ID	Family	RBS	Sequence
SwM_1138192	F061048	AGG	MSLDLVALKDEPSTTRNARPRRSLDLETESVVRVLPIRWRLFS