Scaffold JGIcombinedJ13530_100162812

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGIcombinedJ13530_100162812

Scaffold JGIcombinedJ13530_100162812

Overview

Basic Information
Taxon OID	3300001213 Open in IMG/M
Scaffold ID	JGIcombinedJ13530_100162812 Open in IMG/M
Source Dataset Name	Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	928
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland → Wetland Microbial Communities From Twitchell Island In The Sacramento Delta

Source Dataset Sampling Location
Location Name	Twitchell Island in the Sacramento/San Joaquin Delta, CA
Coordinates	Lat. (^o)	38.107057	Long. (^o)	-121.647578	Alt. (m)		Depth (m)	0 to .12
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050333	Metagenome	145	Y

Sequences

Protein ID	Family	RBS	Sequence
JGIcombinedJ13530_1001628122	F050333	AGGAG	MKKLSVVVAGSGQIRDIQIQPGTTAKDILDQLSLKDYLLSKGPNDPFFVNSDSIYDKVNDGEKIFASTKAEVGILKCA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.