Scaffold J055_10237477

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold J055_10237477

Scaffold J055_10237477

Overview

Basic Information
Taxon OID	3300001199 Open in IMG/M
Scaffold ID	J055_10237477 Open in IMG/M
Source Dataset Name	Lotic microbial communities from nuclear landfill site in Hanford, Washington, USA - IFRC combined assembly
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Pacific Northwest National Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	649
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic → Lotic Microbial Communities From Nuclear Landfill Site In Hanford, Washington, Usa

Source Dataset Sampling Location
Location Name	Hanford, Washington, USA
Coordinates	Lat. (^o)	46.371184	Long. (^o)	-119.275414	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080131	Metagenome / Metatranscriptome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
J055_102374772	F080131	N/A	PVTEVLTSEGYEQTKRKLVELELRLAAIEDRTDLDAEHLASVRRSYKMMMRDYLKEIKLYEAKHSNPNSKSAH*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.