Scaffold JGI10220J13317_11151490

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI10220J13317_11151490

Scaffold JGI10220J13317_11151490

Overview

Basic Information
Taxon OID	3300001139 Open in IMG/M
Scaffold ID	JGI10220J13317_11151490 Open in IMG/M
Source Dataset Name	Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	935
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location
Location Name	Iowa, USA
Coordinates	Lat. (^o)	43.303333	Long. (^o)	-89.3325	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037793	Metagenome	167	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI10220J13317_111514901	F037793	N/A	RVIRMGKFDKQLAHWREQYRLAVEDLENLQSSRKKVAEDTGEGWVDATDHWADRVRNEVAVFAQLIEVYEKLNARNGSS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.