Scaffold JGI1684J13235_1006244

Overview

Basic Information

• Taxon OID: 3300001136
• Scaffold ID: JGI1684J13235_1006244
• Source Dataset Name: Marine sediment microbial community from Fremont, CA, USA - Pond A23 Sediment 2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3166
• Total Scaffold Genes: 11
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (36.36%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico

Source Dataset Sampling Location

• Location Name: Alviso Ponds, San Francisco, CA, USA
• Coordinates
  • Lat. (^o): 37.474067
  • Long. (^o): -121.973033
  • Depth (m): .075

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022890	Metagenome / Metatranscriptome	212	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI1684J13235_10062443	F022890	N/A	MTTRKLVNLMMKSSDHNPYTGKLSESDNVLAAIELAKKFKEFADEGYTDEAMDVESSQWIEVINKLEEKRLNCA*