Scaffold JGI1684J13235_1001955

Overview

Basic Information

• Taxon OID: 3300001136
• Scaffold ID: JGI1684J13235_1001955
• Source Dataset Name: Marine sediment microbial community from Fremont, CA, USA - Pond A23 Sediment 2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6870
• Total Scaffold Genes: 16
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 14 (87.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Halobacteriales (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico

Source Dataset Sampling Location

• Location Name: Alviso Ponds, San Francisco, CA, USA
• Coordinates
  • Lat. (^o): 37.474067
  • Long. (^o): -121.973033
  • Depth (m): .075

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098766	Metagenome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI1684J13235_100195510	F098766	GGAGG	MSHPTCSICGREADGANHVRVEVARVPPEEPPKTYYFHPWCFENAQSWERGV*